Your position:home page » currency symbols » text

old english number fonts

Release time:2017-12-13
45 Free Old English Fonts · 1001 Fonts

 · Largest Font Families · Trending FontsHome<Tags<Old EnglishHello, you seem to have JavaScript turned off. Please enable it to use the advanced features of this website.Old English FontsFonts 1 - 10 of 45old englishxblackletterregulartextcalligraphyheadlinesancientmedievalserifdisplaybracket serifroyalsmall capsvintagefancymediumdecorative1600serodedmajesticsmall textitalicim fellroughgothicnarrowpostergoogle webboldvictorianbritishlightmanuscriptornamentalswashesking arthurdrop capsold worldscriptruniccursivemore……more6pt7pt8pt9pt10pt11pt12pt13pt14pt15pt16pt18pt20pt22pt24pt26pt28pt32pt36pt40pt44pt48pt54pt60pt66pt72pt80pt88pt96pt106pt116pt128pt142pt158pt178pt198pt118pt240ptAA10205010Date addedTrendingPopularityAlphabeticallyNumber of stylesPopularityPermalink BlackChancerybyDoug MilesDownloadRM Albionbyp2pnutDownloadCamelot CapsbyLimeDownloadIM FELL French Canon +2byIgino MariniDownloadOld English HeartsbyLars ManenschijnDownloadDonateAle and Wenches BB +1byBlambot Comic FontsDownloadAnglicanTextbyTypographer MediengestaltungDownloadBlackwood Castle +1byTypographer MediengestaltungDownloadCanterburybyTypographer MediengestaltungDownloadCardiffbyTypographer MediengestaltungDownload


Fancy > Old School fonts

Fancy > Old School fonts


    English     Français    Español    Deutsch    Italiano    PortuguêsLogin  |  RegisterThemesNew fontsAuthorsTopForumFAQSubmit a fontTools google Fancy < Old School 1  2 3 4 5 6 7 Preview Fonts102050100  Show variantsSizeTinySmallMediumLargeSort byNamePopularityNewest  More options Only as  Public domain / GPL / OFL  100% Free  Free for personal use  Donationware  Shareware  Demo  UnknownOnly fonts with  Accents  Euro Varsity à by Br鴇erbund Software  4,884,638 downloads (1,741 yesterday)   256 comments Download  Freshmanby William Boyd  2,153,310 downloads (952 yesterday)   47 comments  100% Free Download  Collegedby imagex   2,361,392 downloads (653 yesterday)   53 comments  Free for personal use Download Donate to author Messe Muenchen à € by Chequered Ink   7,231 downloads (638 yesterday)   Free for personal use Download Donate to author Collegeby Matthew Welch   1,780,116 downloads (599 yesterday)   16 comments  100% Free - 4 font files Download  Allstar à  2,734,049 downloads (503 yesterday)   49 comments Download  Championship à € by imagex   172,612 downloads (446 yesterday)   Free for personal use Download Donate to author Jersey M54by justme54s  783,495 downloads (424 yesterday)   Free for personal use Download Donate to author Sports World à € by Sergiy S. Tkachenko   624,581 downloads (404 yesterday)   2 comments  100% Free - 2 font files Download  Be True To Your School à € by HENRIavecunK  404,304 downloads (396 yesterday)   Free for personal use Download Donate to author Universityby Geronimo  309,272 downloads (387 yesterday)   Free for personal use Download Donate to author Hot National Teamby Fontscafe.com   3,492 downloads (339 yesterday)   Demo Download Donate to author Sketch College à € by Galdino Otten   688,291 downloads (336 yesterday)   4 comments  Free for personal use Download  Athleticby Edward A. Leach  960,851 downloads (311 yesterday)   13 comments  Shareware Download  Superstar M54by justme54s  509,745 downloads (308 yesterday)   Free for personal use Download Donate to author Legend M54by justme54s  525,230 downloads (292 yesterday)   3 comments  Free for personal use Download Donate to author Vintage College Dept Wornby fontsandfashion   304,030 downloads (289 yesterday)   8 comments  Demo Download  Collegiate FLFby Casady & Greene  691,937 downloads (277 yesterday)   18 comments  5 font files Download  Campus Aby Leonard Posavec - LeoSupply.co   289,208 downloads (258 yesterday)   Free for personal use Download Donate to author Millionaire € by paperstreet   105,052 downloads (236 yesterday)   Free for personal use Download Donate to author Fancy < Old School 1  2 3 4 5 6 7 


Old English™ Regular

Old English™ Regular


Monotype Library SubscriptionGet unlimited access to Old English™ Std Regular and over 2,200 other families for only 9.99/month.


Oldstyle Figures

Oldstyle Figures


Numbers are a common element in text. They are used to indicate dates, times, addresses, measurements quantities, prices and other data. In typography, the symbols used to represent numbers are commonly referred to as figures or numerals. Oldstyle figures are one of two styles of numerals, the other being lining figures. Oldstyle figures (also known as non-lining, lowercase, hanging, or text figures) have varying heights and alignments, as opposed to lining figures, which are of uniform height and alignment. Oldstyle figures are similar to lowercase characters in that they share the same x-height and have ascenders (the 6 and 8) and descenders (the 3, 4, 5, 7 and 9). In some typefaces, the design of some of the oldstyle figures varies from the lining figures. Some variations are purely aesthetic (such as a ball terminal added to a figure); others are functional as well (such as serifs added to a tabular sans serif ‘1’ to increase its width and create a look of more even spacing). Oldstyle figures blend in with lowercase, as they have the same x-height, and also have ascenders and descenders. In some typefaces, the oldstyle figures have significant design differences from their lining figure counterparts, as seen here in the ITC Bodoni™ Seventy-Two family. Despite their name, oldstyle figures have many uses in modern typography. This elegant style of figure is pleasing – and often preferred in running text. It is less intrusive than lining figures, allowing the numerals to blend with the surrounding lowercase characters. Oldstyle figures also pair up nicely with small caps. Oldstyle figures look balanced in running text (upper), as they blend with the lowercase, compared to tall lining figures (middle). They also harmonize when used with small caps (lower left) rather than using lining figures (lower right). Set in the ITC Legacy® Serif family. Oldstyle figures can be designed with two different spacing formats: proportional and tabular. [link to Proportional vs. Tabular Figures article] Proportional oldstyle figures are recommended for running text, including dates, times, measurements, and pagination. Tabular oldstyle figures are best reserved for columns of numbers where vertical alignment is desired, such as tables, financial data, and similar listings. The spacing differences between proportional (upper) and tabular (lower) oldstyle figures can clearly be seen in this setting of the Classic Grotesque™ design, especially in the spacing of the numeral 1. Note that serifs have been added to the tabular 1 to widen the character, creating more even spacing with the other tabular figures. Prior to the OpenType font format, oldstyle figures were not widely available. Earlier font formats (Type1 and TrueType) only had “room” for one set of numerals, most commonly tabular lining figures. OpenType’s capacity to accommodate thousands of characters in a given font, has made oldstyle figures sometimes with both tabular and proportional spacing formats much more common. Decide on your preferred figure style(s) at the onset of a design project, and conduct your typeface exploration with these requirements in mind. This will ensure that the typefaces you choose will meet your “numerical” needs. Fortunately, an expanding number of OpenType fonts provide more than one figure style. To take advantage of all that a font offers, it’s essential to know how to determine which figure styles it contains, as well as how to select them from within your software. All trademarks are the property of their respective owners. Additional information regarding Monotype’s trademarks is available at monotype.com/legal. Fontology is a trademark of Monotype Imaging and may be registered in certain jurisdictions.


Best 25+ Number fonts ideas on Pinterest

Best 25+ Number fonts ideas on Pinterest


DIY and craftsarrow-forwardNumber fontsNumber fontsChalkboard numbersNumber tattoo fontsHandwriting fontsNumber typographyPretty fonts alphabetNumber calligraphyNumber fonts for tattoosCalligraphy lettersTypography alphabetFancy numbersCursive numbersChalkboard fontsHandwriting fonts alphabetHand lettering fontsCalligraphy alphabetLetter fontsCaligraphy alphabetFancy lettering alphabetVintage numbersBeautiful calligraphyThe Twelve Best Number Fonts (A Typical English Home)Fonts For TattoosTattoo Lettering FontsKid TattoosNumber Tattoo FontsNumber TattoosNumber FontsDate TattoosNumber CalligraphyNumber TypographyForwardThe Twelve Best Number Fonts - A Typical English Home: on left foot- marching band tattoo See MoreSassafras Lass - Clear Stamp Sets - Swirly Numbers, CLEARANCENumber FontsNumber Tattoo FontsNumber TattoosCursive Fonts AlphabetFancy Lettering AlphabetGraffiti Alphabet FontsGraffiti Lettering FontsCool LetteringNumber TypographyForwardSassafras Lass - Clear Stamp Sets - Swirly Numbers, CLEARANCE: The Swirly Numbers Clear Stamps from Sassafras Lass are a simple way to add a unique touch to all of your projects. These fun stamps are sure to dress up your scrapbook layouts, See MoreNumber Free FontsChalkboard NumbersChalkboard Art FontsChalk FontsChalkboard DesignsChalkboard IdeasNumber FontsNumber Tattoo FontsNumber 13 TattoosNumber TypographyForwardFree Fonts and Printable Combinations - Chalkboard number fonts See MoreNumber Tattoo FontsNumber TattoosFonts For TattoosNumber FontsFont TattooTattoo ArtGraffiti AlphabetAlphabet FontsGraffiti NumbersForwardDifferent Graffiti Alphabet Fonts – LHF Unlovableby graffiti fonts numbersSee MoreAnniversary GreetingsAnniversary ScrapbookCricut Anniversary CardBirthday Scrapbook LayoutsLove ScrapbookScrapbook PaperFree Printable Anniversary CardsScrapbook TitlesAnniversary PartiesForwardFree freebees gratis SVG file and or scut file scrapbook paper pierciering Numbers love these for my postcards. Great for Birthday / Anniversary greetings.See MoreMy Favorite Free Number Fonts!Number Tattoo FontsNumber TattoosNumber TypographyNumber CalligraphyNumber Font StylesNumber FontsNew Tattoo DesignsChalkboard NumbersNumber StencilsForwardMy Favorite Free Number Fonts tjn See MoreNumber TattoosNumber Tattoo FontsCoordinates TattooTattoo Font ScriptNumber Font StylesNumber FontsHair TattoosTattoo TimeLatitude Longitude TattooForwardFor my longitude latitude tatSee MoreNumber FontsNumber 2Number Tattoo FontsNumber TattoosNumber PostersLondonGraphicsGraphic DesignText DesignForwardLondon Font - Numbers for centre piecesSee MoreI love Numbered Things! {and a list of my favorite number fonts with linksNumber FontsNumber VectorNumber ArtFont FreeFree Fonts For CricutMonogram Fonts FreeTop Free FontsFree Fonts DownloadMonogramsForwardTop 15 favorite FREE number fonts with links! Great for Typography and numbered DIY projects! Collected by Ella Claire Inspired. See MoreTypography ServedTypography FontsCalligraphy FontsTypography DesignNumber CalligraphyHandletteringFont ArtArt Deco FontHipster FontsForwardfile name: Pedro Lobo Darko 2013See MoreNumber LogosStationary DesignHouse NumbersCraft ProjectsProject IdeasNew FontsAlphabetCreative ReviewTattoo IdeasForwardCreative Review - New typeface: Bella from Face37 love this font for numbersSee MoreNumber Tattoo FontsNumber FontsNumber TattoosNumber 13Number TypographyNumber CalligraphyCalligraphy AlphabetCalligraphy FontsMailbox NumbersForwardNumbers (use as stencils to paint on house number?See MoreNumber FontsNumber Tattoo FontsNumber CalligraphyBullet JournalFuture TattoosHandwritingLetteringThe JourneyDrawForwardSPEAKEASY FONT NumberSee MoreLettering TutorialLettering IdeasHand LetteringAddress NumbersChalkboard NumbersChalk ArtNumber Tattoo FontsNumber FontsBullet JournalForwardArt du Jour by Martha Lever: Giveaway and some ExemplarsSee MoreChalkboard FontsChalkboard Lettering AlphabetFull Alphabet FontsChalkboard NumbersLetter FontsBlackboard MenuChalkboard WritingSign WritingHand Lettering FontsForward"Chalk Hand Lettering" font (many examples)See MoreSTENCIL Paris French Script Numbers Bride Lake House Address Old Primitive SignsNumber StencilsStencils For SignsCricut StencilsHouse AddressFrench ScriptPrimitive SignsCountry PrimitivePrimitive DecorStencil DesignsForwardSTENCIL Paris French Script Numbers Bride Lake House Address Old Primitive Signs in Crafts, Home Arts & Crafts, Decorative & Tole Painting, Stencils See MorePinterestSearchPrivacy


Old English/Numbers

Old English/Numbers


Old English/NumbersFrom Wikibooks, open books for an open world > Old EnglishThe latest reviewed versionwas checkedon 30 August 2017. There are 2 pending changesawaiting review.Jump to: navigation, searchIntroduction: Introduction- Grammar- Orthography- I-mutation Grammar: Nouns- Pronouns- Articles- Adjectives- Numbers- Verbs- Participles- Adverbs- Conjunctions- Prepositions- Interjections- Appositives- Word Formation- In Old English, numbers or more specifically numerals are almost all recognizably related to those of Modern English, so they shouldn't be too hard to learn for a Modern English speaker. Cardinal numbers[edit]Cardinal numbers are the type of number that are used to count and enumerate things, like "one", "two", and "three" in Modern English, as in "there are three pigs". Cardinal numbers in Old English could either be declined adjectivally in declension agreement with whatever they were referring to, or treated like a noun which would be followed by the genetive plural of whatever they were referring to. The Old English words for 1, 2, and 3 were always treated in the former manner - like an adjective that modified a noun or a pronoun. Here are the declensions of these cardial numerals: "Ān" - "one"CaseMasculineNeuterFeminineNom. and acc.ān


Olde English

Olde English


    English     Français    Español    Deutsch    Italiano    PortuguêsLogin  |  RegisterThemesNew fontsAuthorsTopForumFAQSubmit a fontTools google5 matching requests on the forumOlde EnglishCustom preview Fonts102050100  Show variantsSizeTinySmallMediumLargeSort byNamePopularityNewest  More options Only as  Public domain / GPL / OFL  100% Free  Free for personal use  Donationware  Shareware  Demo  UnknownOnly fonts with  Accents  Euro Olde English à by Dieter Steffmann in Gothic< Medieval 1,634,691 downloads (504 yesterday)   11 comments  100% Free Download 


Best 25+ Old english font ideas on Pinterest

Best 25+ Old english font ideas on Pinterest


Artarrow-forwardOld english fontOld english fontOld english tattooOld englishOld english alphabetOld style fontBlack letterAlphabet writing styleEnglish alphabet writingEnglish alphabet lettersGothic letteringTattoo lettering fontsGraffiti alphabet fontsOld english decorNumber font stylesEnglish typingGothic alphabetFancy lettersFancy lettering alphabetOld english text fontGothic fontsGothic textTattoo Lettering DesignFont TattooDesign TattoosTattoo Writing FontsHand LetteringChicano LetteringCool LetteringTattoo DesignsOld English TattooForwardOld English Font Tattoos Text Designs Tattoo:See MoreAlphabet StencilsFont AlphabetEnglish AlphabetGraffiti Alphabet FontsRoman AlphabetHandwriting AlphabetStencil GraffitiAlphabet DesignLetter FontsForwardbe cool to do a T in the Old English StencilSee MoreAlphabet CodeAlphabet LettersOld English TattooOld English FontHandwriting FontsTypography FontsLetteringAbcsBullet JournalForwardold english letteringSee MoreEnglish StyleOld English FontEnglish AlphabetOld English TattooCalligraphy AlphabetNumber CalligraphyFancy Fonts AlphabetScript AlphabetFont Styles AlphabetForwardLetterhead Fonts / LHF New English / Old English Style Fonts Slab Serif/DecorativeSee MoreCalligraphy Fonts AlphabetTattoo Writing FontsTattoo Lettering AlphabetWriting Styles FontsTattoo Lettering StylesFont TattooPenmanshipScript TattoosScript AlphabetForwardold english calligraphySee MoreOld English FontOld English TattooEnglish StyleEnglish AlphabetTattoo Font StylesTattoo Lettering FontsFont TattooTattoo DesignsTattoo Writing FontsForwardTribal Tattoo Letters, Tattoo Words Wording and Lettering Styles Arabic letters can make for terrific tattoo ideas mainly because they Tatt.See MoreScar TattooArm TattoosOld English FontOld English TattooTattoo AlphabetFancy FontsTattoo FontsCalligraphy LettersFuture TattoosForwardOld English -- need to find a good chart for the lowercase though.See MoreHistorycal - 2 Font StylesVintage FontsOld FontsVintage DesignsGraphic Design FontsGraphic Design TutorialsTypography FontsFont LogoTypography DesignAlphabet FontsForwardHistorycal - 2 Font Styles by DikasStudio Hello friend, let me introduce my product Historycal ¨C 2 Font Styles Yes, Historycal have 2 Style : Clean & Inline with vintage c See MoreAlphabet DesignAlphabet FontsAlphabet LettersFont TattooFonts For TattoosStencil LetteringHand LetteringEnglish AlphabetBooks For ChildrenForwardAunt Louisa's First Book for Children - Typography - Old English FontSee MoreGothic LettersTattoo Lettering StylesLettering ArtTattoo Writing FontsTattoo Writing StylesLettering Styles AlphabetFont TattooTattoo ArtTatooTypography AlphabetForwardOld English Style Letters :: Image 10 Más See MoreTattoo Lettering AlphabetHand LetteringLetter TattoosTattoo Font ScriptTattoo Lettering StylesTattoo Fonts For NamesTatto LettersGraffiti Alphabet FontsTattoo Writing StylesForwardGraffiti Alphabet : Sketch Letter Graffiti Alphabet Font A To Z With Chicano Letter Style For Lettering Tattoo Design Alphabet A Z for Letter Tattoo DesignSee MoreGothic TextGothic LetteringGothic FontsAlphabet LettersCaligraphy AlphabetOld LettersPenmanshipHandwriting FontsNice FontsForwardSpeedball lettering-Old EnglishSee Moreby pilllpat (agence eureka)Old English FontOld English TattooGothic FontsCalligraphy PensCalligraphy AlphabetViết TayTattoo IdeasHd WallpaperWriting StylesForwardType design pages for Ross F. Ross F. George: Speedball 10 Type design information compiled and maintained by Luc Devroye.See MoreOld English Upper TogetherGothic FontsGothic LetteringOld English FontEnglish AlphabetOld English TattooLetter FontsAlphabet Letters To PrintFont Styles AlphabetFancy Fonts AlphabetForwardOld English calligraphy, also referred to as blackletter script, means "beautiful writing," derived from the Greek words "calli" an.See MoreHand Lettering AlphabetCalligraphy AlphabetLearn CalligraphyOld English FontOld English TattooAlphabet SoupAlphabet LettersLetter FontsFancy LettersForwardLetterhead Fonts / LHF Tributary / Old English Fonts - I like the lowercase letters and numbers-See MorePinterestSearchPrivacy


Fonts ~ Creative Market

Ready to useFontsFind over 18k fonts to use in design projects of all kinds for web and print. These font sets feature hand-drawn, brush, and vector letterforms, along with extra character sets and embellishments for headers, text, and display.

source : international currency ,Welcome to reprint and share。

Related articles

Some netizens have made a critical comment. What are you waiting for?Come on

Required

Optional

Optional

Remember, I don't need to re-enter my personal information next time